PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK11173.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 405aa    MW: 47144.6 Da    PI: 6.6126
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK11173.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.41.9e-5561351129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                +ppGfrFhPtdeelv +yL+kk++++k++l +vi+++d+y++ePwdL++     ++e++ewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+v++ k 
  PK11173.1   6 VPPGFRFHPTDEELVGYYLRKKIASQKIDL-DVIRDIDLYRIEPWDLQErcrIGYEEQNEWYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKAVYD-KA 103
                69****************************.9***************953432233667**************************************.99 PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                +l+g++ktLvfykgrap+g+ktdW+mheyrle
  PK11173.1 104 RLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 135
                9*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.81E-613155IPR003441NAC domain
PROSITE profilePS5100559.7476155IPR003441NAC domain
PfamPF023659.1E-297134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:1990110Biological Processcallus formation
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MESSSVPPGF RFHPTDEELV GYYLRKKIAS QKIDLDVIRD IDLYRIEPWD LQERCRIGYE  60
EQNEWYFFSH KDKKYPTGTR TNRATMAGFW KATGRDKAVY DKARLIGMRK TLVFYKGRAP  120
NGQKTDWIMH EYRLESDENG PPQEEGWVVC RAFKKRTTSN GQTKTIEGWE SAGYFYDESS  180
NGVSSVVADH HRHHHHHHHH QIDNYISRHN NNPQPHHPHH HHNQSFIMCK QELEGDSLLS  240
FNNLLQQNHQ FVQQLPQLES PSLPLKRPAS SVSLVTEIVN EEDQHNNQDQ SDDHIINNNN  300
NNNINKKKKV VTTDWRALDK FVASQLSQDD HEDHNNNNNN NNSNNNNESI FGVSSHDHHH  360
HHHEETDTTS FMLLAQSSID EGNRLNAFLN SSSLDCDFGI CIFEK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-51515916169NAC domain-containing protein 19
4dul_A3e-51515916169NAC domain-containing protein 19
1ut7_B3e-51515916169NO APICAL MERISTEM PROTEIN
1ut7_A3e-51515916169NO APICAL MERISTEM PROTEIN
1ut4_B3e-51515916169NO APICAL MERISTEM PROTEIN
1ut4_A3e-51515916169NO APICAL MERISTEM PROTEIN
3ulx_A4e-51615615169Stress-induced transcription factor NAC1
3swp_D4e-51515919172NAC domain-containing protein 19
3swp_C4e-51515919172NAC domain-containing protein 19
3swp_B4e-51515919172NAC domain-containing protein 19
3swp_A4e-51515919172NAC domain-containing protein 19
3swm_D4e-51515919172NAC domain-containing protein 19
3swm_C4e-51515919172NAC domain-containing protein 19
3swm_B4e-51515919172NAC domain-containing protein 19
3swm_A4e-51515919172NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00266DAPTransfer from AT2G18060Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010113376.11e-170NAC domain-containing protein 7
SwissprotQ9SL411e-149NAC37_ARATH; NAC domain-containing protein 37
TrEMBLW9SCT61e-170W9SCT6_9R
STRINGVIT_04s0023g03110.t011e-164(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45653459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-127vascular related NAC-domain protein 1